Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TrkC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25838325UL
Description
TrkC Polyclonal specifically detects TrkC in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
TrkC | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
EC 2.7.10, EC 2.7.10.1, ETS related protein-neurotrophic receptor tyrosine kinase fusion protein, ETV6-NTRK3 fusion, gp145(trkC), GP145-TrkC, Neurotrophic tyrosine kinase receptor type 3, neurotrophic tyrosine kinase, receptor, type 3, NT 3 receptor, NT-3 growth factor receptor, Trk-C, TrkC tyrosine kinase, TRKCneurotrophin 3 receptor, tyrosine kinase receptor C | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
NTRK3 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRS | |
25 μL | |
Cancer, Protein Kinase | |
4916 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction