TRM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP182198

Catalog No. NBP182198

Description

TRM1 Polyclonal specifically detects TRM1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TRM1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9NXH9
• Gene Symbols: TRMT1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LLHADFRVSLSHACKNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDANPS
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human TRM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.1.1.32, FLJ20244, N(2)-N(2)-dimethylguanosine tRNA methyltransferase, TRM1, TRM1 tRNA methyltransferase 1 homolog (S. cerevisiae), tRNA 2,2-dimethylguanosine-26 methyltransferase, tRNA(guanine-26, N(2)-N(2)) methyltransferase, tRNA(m(2,2)G26)dimethyltransferase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55621
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only