TRM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB407221	Novus Biologicals NBP18219725UL	25 μL
NBP182197	Novus Biologicals NBP182197	0.1 mL

Description

TRM1 Polyclonal specifically detects TRM1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TRM1
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.1.1.32, FLJ20244, N(2)-N(2)-dimethylguanosine tRNA methyltransferase, TRM1, TRM1 tRNA methyltransferase 1 homolog (S. cerevisiae), tRNA 2,2-dimethylguanosine-26 methyltransferase, tRNA(guanine-26, N(2)-N(2)) methyltransferase, tRNA(m(2,2)G26)dimethyltransferase
• Gene Symbols: TRMT1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q9NXH9
• Gene ID (Entrez): 55621
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSANPGRFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTP
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only