Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$254.42 - $728.30
Specifications
| Antigen | TRM1 |
|---|---|
| Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
TRM1 Polyclonal specifically detects TRM1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| TRM1 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 2.1.1.32, FLJ20244, N(2)-N(2)-dimethylguanosine tRNA methyltransferase, TRM1, TRM1 tRNA methyltransferase 1 homolog (S. cerevisiae), tRNA 2,2-dimethylguanosine-26 methyltransferase, tRNA(guanine-26, N(2)-N(2)) methyltransferase, tRNA(m(2,2)G26)dimethyltransferase | |
| TRMT1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9NXH9 | |
| 55621 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSANPGRFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title