TRMT12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB418854	Novus Biologicals NBP18363325UL	25 μL
NBP183633	Novus Biologicals NBP183633	0.1 mL

Description

TRMT12 Polyclonal specifically detects TRMT12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TRMT12
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 55039
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:WFTQRYREYLQRQKLFDTQHRVEKMPDGSVALPVLGETLPEQHLQELRNRVAPGSPCMLTQLPDPVPSKRAQGCSPAQKLCLEVSRWVE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: Alpha-amino-alpha-carboxypropyl transferase TYW2, EC 2.1.1, EC 2.1.1.32, EC 2.5.1.-, FLJ20772, homolog of yeast tRNA methyltransferase, Trm12, tRNA methyltranferase 12 homolog, tRNA methyltranferase 12 homolog (S. cerevisiae), tRNA methyltransferase 12 homolog (S. cerevisiae), tRNA-yW synthesizing protein 2, tRNA-yW-synthesizing protein 2, TYW2tRNA wybutosine-synthesizing protein 2 homolog
• Gene Symbols: TRMT12
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only