Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRMT2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	TRMT2B
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP155171 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP155171	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

TRMT2B Polyclonal specifically detects TRMT2B in Human samples. It is validated for Western Blot.

Specifications

Antigen	TRMT2B
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	chromosome X open reading frame 34, CXorf34, dJ341D10.3, EC 2.1.1.35, FLJ12687, TRM2 homolog, TRM2 tRNA methyltransferase 2 homolog B (S. cerevisiae), tRNA (uracil-5-)-methyltransferase homolog
Gene Symbols	TRMT2B
Isotype	IgG
Purification Method	Protein A purified

Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Gene Accession No.	Q96GJ1
Gene ID (Entrez)	79979
Immunogen	Synthetic peptides corresponding to CXORF34 The peptide sequence was selected from the middle region of CXORF34. Peptide sequence GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA.
Primary or Secondary	Primary
Molecular Weight of Antigen	56 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

TRMT2B Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents