Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRMT5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TRMT5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TRMT5 Polyclonal specifically detects TRMT5 in Human samples. It is validated for Western Blot.Specifications
TRMT5 | |
Polyclonal | |
Rabbit | |
Q32P41 | |
57570 | |
Synthetic peptides corresponding to TRMT5(TRM5 tRNA methyltransferase 5 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of TRMT5. Peptide sequence EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
KIAA1393EC 2.1.1.31, M1G-methyltransferase, TRM5 tRNA methyltransferase 5 homolog (S. cerevisiae), TRM5MGC111453, tRNA (guanine-N(1)-)-methyltransferase, tRNA [GM37] methyltransferase, tRNA methyltransferase 5, tRNA-N1G37 methyltransferase | |
TRMT5 | |
IgG | |
58 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title