Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Tropomodulin 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | Tropomodulin 2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Tropomodulin 2 Polyclonal specifically detects Tropomodulin 2 in Human samples. It is validated for Western Blot.Specifications
| Tropomodulin 2 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| MGC39481, Neuronal tropomodulin, N-Tmod, NTMODtropomodulin-2, tropomodulin 2 (neuronal) | |
| TMOD2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_055363 | |
| 29767 | |
| Synthetic peptide directed towards the N terminal of human TMOD2. Peptide sequence MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADI. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title