Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRPM7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$330.00 - $547.00

Specifications

Antigen	TRPM7
Dilution	Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Applications	Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB236243 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP32125925UL	25 μg	Each for $330.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB238496 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP321259100UL	100 μg	Each for $547.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

TRPM7 Polyclonal antibody specifically detects TRPM7 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	TRPM7
Applications	Immunofluorescence
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Neurodegeneration, Neuronal Cell Markers, Neuroscience, Neurotransmission
Formulation	PBS, pH 7.2, 40% glycerol
Gene ID (Entrez)	54822
Isotype	IgG
Purification Method	Affinity purified

Dilution	Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	CHAK, CHAK1FLJ25718, Channel-kinase 1, EC 2.7.11.1, Long transient receptor potential channel 7, LTRPC ion channel family member 7, LTrpC7, LTrpC-7, LTRPC7FLJ20117, transient receptor potential cation channel subfamily M member 7, transient receptor potential cation channel, subfamily M, member 7, transient receptor potential-phospholipase C-interacting kinase, TRP-PLIK
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: LPGCQICQQLVRCFCGRLVKQHACFTASLAMKYSDVKLGDHFNQAIEEWSVEKHTEQSPTDAYGVINFQGGSHSYR
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

TRPM7 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents