Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRPM8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | TRPM8 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
TRPM8 Polyclonal specifically detects TRPM8 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| TRPM8 | |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| Rabbit | |
| Cancer, Tumor Suppressors | |
| PBS buffer, 2% sucrose | |
| 79054 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Long transient receptor potential channel 6, LTrpC-6, LTRPC6, MGC2849, short form of the TRPM8 cationic channel, transient receptor potential cation channel, subfamily M, member 8, Transient receptor potential p8, transient receptor potential subfamily M member 8, trp-p8, TRPP8transient receptor potential cation channel subfamily M member 8 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM8 (NP_076985). Peptide sequence YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title