Invitrogen™ TRPV5 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595269

Catalog No. PIPA595269

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Pancreas Tissue, Rat Lung Tissue, Rat Intestine Tissue, SW620 whole cell, COLO320 whole cell, 293T whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. This protein forms homotetramers or heterotetramers and is activated by a low internal calcium level.

Specifications

• Antigen: TRPV5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: TRPV5
• Gene Alias: Calciu; Calcium transport protein 2; calcium transporter 2; CaT2; D630033B11; ECAC; Ecac1; epithelial calcium channel; epithelial calcium channel 1; Osm-9-like TRP channel 3; OTRPC3; Transient receptor potential cation channel subfamily V member 5; transient receptor potential cation channel, subfamily V, member 5; Trpv5
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 116469, 56302
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q9JIP0, Q9NQA5
• Gene Symbols: TRPV5
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TRPV5 (580-610aa DTHWRVAQERDELWRAQVVATTVMLERKLPR).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody
• Isotype: IgG