Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89965884

Abnova™ trxA (Escherichia coli) Recombinant Protein

Catalog No. 89965884
Click to view available options
Quantity:
50 μg

Description

Used for Func, SDS-PAGE

Sequence: MHHHHHHMGSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGS

Specifications

Accession Number ACB04810
Concentration 0.5 mg/mL
For Use With (Application) Functional Study, SDS-PAGE
Formulation Liquid
Gene ID (Entrez) 6061668
Molecular Weight (g/mol) 34.6kDa
Name trxA (Escherichia coli) Recombinant protein
Preparation Method Escherichia coli expression system
Purification Method Conventional Chromatography
Quality Control Testing 15% SDS-PAGE Stained with Coomassie Blue
Quantity 50 μg
Immunogen MHHHHHHMGSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGS
Storage Requirements Store at 4°C. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Common Name trxA
Gene Symbol trxA
Biological Activity Specific activity is 16 ∽18 A650/min/mg and was obtained by measuring the increase of insulin precipitation in absorbance at 650nm resulting from the reduction of insulin.
Species E. coli
Protein Tag His
Expression System Escherichia coli expression system
Form Liquid
Purity or Quality Grade >85% by SDS-PAGE
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.