Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRXR3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | TRXR3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19828720
|
Novus Biologicals
NBP19828720UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP198287
|
Novus Biologicals
NBP198287 |
100 μL |
Each for $482.50
|
|
|||||
Description
TRXR3 Polyclonal specifically detects TRXR3 in Human samples. It is validated for Western Blot.Specifications
| TRXR3 | |
| Polyclonal | |
| Rabbit | |
| NP_001166984 | |
| 114112 | |
| The immunogen for this antibody is TRXR3 - middle region. Peptide sequence NHISSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNKKGQETYYTAAQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| TGR, thioredoxin reductase 3, TR2, TRXR3 | |
| TXNRD3 | |
| IgG | |
| 66 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title