Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Tryptase gamma-1/TPSG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | Tryptase gamma-1/TPSG1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Tryptase gamma-1/TPSG1 Polyclonal specifically detects Tryptase gamma-1/TPSG1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Tryptase gamma-1/TPSG1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 3.4.21, EC 3.4.21.-, gamma I, gamma II, lung tryptase, mast cell protease II, mast cell tryptase, PRSS31skin tryptase, Serine protease 31, TMTpituitary tryptase, Transmembrane tryptase, trpA, tryptase gamma, tryptase gamma 1, tryptase gamma I, tryptase gamma II | |
| TPSG1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9NRR2 | |
| 25823 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCAR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title