Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TSPAN12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TSPAN12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TSPAN12 Polyclonal specifically detects TSPAN12 in Human samples. It is validated for Western Blot.Specifications
TSPAN12 | |
Polyclonal | |
Rabbit | |
NP_036470 | |
23554 | |
Synthetic peptide directed towards the middle region of human TSPAN12. Peptide sequence: DSCCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGI | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Leukemia-associated protein with a CXXC domain, methylcytosine dioxygenase TET1, NET-2, ten-eleven translocation-1, tetraspanin-12 | |
TSPAN12 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title