Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TSPAN17 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TSPAN17 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TSPAN17 Polyclonal specifically detects TSPAN17 in Human samples. It is validated for Western Blot.Specifications
TSPAN17 | |
Polyclonal | |
Rabbit | |
F-box only protein 23, FBXO23, MGC14859, MGC71255, Tetraspan protein SB134, tetraspanin 17, tetraspanin-17, TM4SF17, transmembrane 4 superfamily member 17, Tspan-17 | |
TSPAN17 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
26262 | |
Synthetic peptides corresponding to TSPAN17(tetraspanin 17) The peptide sequence was selected from the N terminal of TSPAN17. Peptide sequence GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWI. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title