TSPAN2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159226

Catalog No. NBP159226

Description

TSPAN2 Polyclonal specifically detects TSPAN2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TSPAN2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ12082, NET3, new EST tetraspan 3, tetraspan 2, Tetraspan NET-3, tetraspan TM4SF, tetraspanin 2, tetraspanin 2 isoform, tetraspanin-2, TSN2, TSPAN-2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10100
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O60636
• Gene Symbols: TSPAN2
• Immunogen: Synthetic peptides corresponding to TSPAN2(tetraspanin 2) The peptide sequence was selected from the middle region of TSPAN2. Peptide sequence FAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rabbit: 85%; Bovine: 78%; Canine: 78%; Equine: 78%; Mouse: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only