Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TSPAN33 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17407020UL
Description
TSPAN33 Polyclonal specifically detects TSPAN33 in Rat samples. It is validated for Western Blot.Specifications
TSPAN33 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
D3Z967 | |
TSPAN33 | |
Synthetic peptides corresponding to the C terminal of Tspan33. Immunizing peptide sequence NTMCGQGMQALDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIP. | |
Affinity Purified | |
RUO | |
340348 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
hPen, proerythroblast new membrane, tetraspanin 33, tetraspanin-33, tspan-33 | |
Rabbit | |
31 kDa | |
20 μL | |
Primary | |
Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction