Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TSPAN33 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | TSPAN33 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19146520
|
Novus Biologicals
NBP19146520UL |
20 μL |
Each for $204.00
|
|
|||||
NBP191465
|
Novus Biologicals
NBP191465 |
100 μL |
Each for $482.50
|
|
|||||
Description
TSPAN33 Polyclonal specifically detects TSPAN33 in Human samples. It is validated for Western Blot.Specifications
TSPAN33 | |
Polyclonal | |
Rabbit | |
NP_848657 | |
340348 | |
Synthetic peptide directed towards the middle region of human TSPAN33. Peptide sequence LQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSC. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
hPen, proerythroblast new membrane, tetraspanin 33, tetraspanin-33, tspan-33 | |
TSPAN33 | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title