Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TSPY4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | TSPY4 |
---|---|
Dilution | Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
TSPY4 Polyclonal specifically detects TSPY4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TSPY4 | |
Polyclonal | |
Purified | |
RUO | |
728395 | |
This antibody was developed against a recombinant protein corresponding to the amino acid sequence:EEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAF | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Unconjugated | |
Rabbit | |
Testis Specific Protein, Y-Linked 4, Testis-Specific Y-Encoded Protein 4, TSPY10, TSPY8 | |
TSPY4 | |
IgG | |
Protein A purified |
For Research Use Only (RUO)
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title