Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TSR1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | TSR1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15534920
|
Novus Biologicals
NBP15534920UL |
20 μL |
Each for $152.22
|
|
NBP155349
|
Novus Biologicals
NBP155349 |
100 μL |
Each for $436.00
|
|
Description
TSR1 Polyclonal specifically detects TSR1 in Human samples. It is validated for Western Blot.Specifications
| TSR1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ10534, KIAA1401, MGC131829, pre-rRNA-processing protein TSR1 homolog, TSR1, 20S rRNA accumulation, homolog (S. cerevisiae), TSR1, 20S rRNA accumulation, homolog (yeast) | |
| TSR1 | |
| IgG | |
| Affinity Purified | |
| 92 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q2NL82 | |
| 55720 | |
| Synthetic peptides corresponding to TSR1(TSR1, 20S rRNA accumulation, homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of TSR1. Peptide sequence MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title