Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TSSK4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | TSSK4 |
---|---|
Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
TSSK4 Polyclonal antibody specifically detects TSSK4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
TSSK4 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Protein Phosphatase | |
PBS (pH 7.2) and 40% Glycerol | |
283629 | |
IgG | |
Protein A purified |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
C14orf20, EC 2.7.11, EC 2.7.11.1, MGC133264, serine/threonine kinase 22E, Serine/threonine-protein kinase 22E, STK22E, Testis-specific kinase 4, testis-specific serine kinase 4, testis-specific serine/threonine-protein kinase 4, TSK-4, TSSK-4, TSSK5TSK4 | |
This antibody was developed against a recombinant protein corresponding to amino acids: DFGFAKMVPSNQPVGCSPSYRQVNCFSHLSQTYCGSFAYACPEILRGLPYNPFLSDTWS | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title