TTC21B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP19041625UL

Catalog No. NB430362

Description

TTC21B Polyclonal specifically detects TTC21B in Human, Zebrafish samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TTC21B
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: ATD4, JBTS11, KIAA1992, putative protein product of Nbla10696, tetratricopeptide repeat domain 21B, tetratricopeptide repeat protein 21B, THM1, TPR repeat protein 21B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79809
• Target Species: Human, Zebrafish
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TTC21B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ALAHEPVNELSALMEDGRCQVLLAKVYSKMEKLGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDYE
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human TTC21B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only