Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TTC6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | TTC6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154927
|
Novus Biologicals
NBP154927 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP15492720
|
Novus Biologicals
NBP15492720UL |
20 μL | N/A | N/A | N/A | ||||
Description
TTC6 Polyclonal specifically detects TTC6 in Human samples. It is validated for Western Blot.Specifications
| TTC6 | |
| Polyclonal | |
| Rabbit | |
| Q86TZ1 | |
| 319089 | |
| Synthetic peptides corresponding to TTC6(tetratricopeptide repeat domain 6) The peptide sequence was selected from the C terminal of TTC6. Peptide sequence MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C14orf25, NCRNA00291, TTC6 tetratricopeptide repeat domain 6 | |
| TTC6 | |
| IgG | |
| 59 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title