TTC7B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP231715

Catalog No. NBP231715

Description

TTC7B Polyclonal specifically detects TTC7B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TTC7B
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q86TV6
• Gene Symbols: TTC7B
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SECQWERIPELVKQLSAKLIANDDMAELLLGESKLEQYLKEHPLRQGASPRGPKPQLTEVRKHLTAALDRGNLKSEFLQESNLIMAKLNYVEGDY
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: c14_5685, tetratricopeptide repeat domain 7 like 1, tetratricopeptide repeat domain 7B, tetratricopeptide repeat protein 7B, Tetratricopeptide repeat protein 7-like-1, TPR repeat protein 7B, TPR repeat protein 7-like-1, TTC7L1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 145567
• Target Species: Human
• Isotype: IgG

For Research Use Only