Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TTF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $728.30

Specifications

Antigen	TTF2
Applications	Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP257736 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP257736	100 μL	Each for $728.30	Only null left	Sign In or Register to check your price. Add to Cart

NB393804 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25773625UL	25 μL	Each for $382.00	Only null left	Sign In or Register to check your price. Add to Cart

Description

TTF2 Polyclonal specifically detects TTF2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	TTF2
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene ID (Entrez)	8458
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSKEHSVSNKSQHASETFHHSSNWLRNPFKVLDKNQEPALWKQLIKGE
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	EC 3.6.1, EC 3.6.4.-, F2, HuF2lodestar protein, human factor 2, Lodestar homolog, RNA polymerase II termination factor, Transcription release factor 2, transcription termination factor 2, transcription termination factor, RNA polymerase II
Gene Symbols	TTF2
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

TTF2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents