Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TUG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19007925UL
Description
TUG Polyclonal specifically detects TUG in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
TUG | |
Polyclonal | |
Western Blot 1:100-1:500, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Alveolar soft part sarcoma chromosomal region candidate gene 1 protein, alveolar soft part sarcoma chromosome region, candidate 1, Alveolar soft part sarcoma locus, ASPLUBX domain-containing protein 9, ASPSrenal cell carcinoma gene on chromosome 17, RCC17renal cell carcinoma, papillary, 17, Renal papillary cell carcinoma protein 17, tether containing UBX domain for GLUT4, TUG, UBX domain protein 9, UBXD9ASPCR1, UBXN9FLJ45380 | |
Rabbit | |
Affinity Purified | |
RUO | |
79058 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ASPSCR1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:GSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSS | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction