TUG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP190079

Catalog No. NBP190079

Description

TUG Polyclonal specifically detects TUG in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TUG
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:500, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: Alveolar soft part sarcoma chromosomal region candidate gene 1 protein, alveolar soft part sarcoma chromosome region, candidate 1, Alveolar soft part sarcoma locus, ASPLUBX domain-containing protein 9, ASPSrenal cell carcinoma gene on chromosome 17, RCC17renal cell carcinoma, papillary, 17, Renal papillary cell carcinoma protein 17, tether containing UBX domain for GLUT4, TUG, UBX domain protein 9, UBXD9ASPCR1, UBXN9FLJ45380
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79058
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ASPSCR1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSS
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only