Learn More
Description
Specifications
Specifications
| Antigen | TXNDC12 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | AG1, AGR1, anterior gradient homolog 1, EC 1.8.4.2, endoplasmic reticulum protein ERp19, Endoplasmic reticulum resident protein 18, Endoplasmic reticulum resident protein 19, endoplasmic reticulum thioredoxin superfamily member, 18 kDa, ER protein 18, ER protein 19, ERP16, ERp18, ERP18AG1, ERP19, hAG-1, hTLP19, PDIA16, protein disulfide isomerase family A, member 16, thioredoxin domain containing 12 (endoplasmic reticulum), thioredoxin domain-containing protein 12, Thioredoxin-like protein p19, TLP19, TLP19hTLP19, TXNDC12 thioredoxin domain containing 12 (endoplasmic reticulum) |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TXNDC12 (NP_056997). Peptide sequence METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEA |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
