TXNDC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24871925UL

Catalog No. NB396020

Description

TXNDC6 Polyclonal antibody specifically detects TXNDC6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: TXNDC6
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: MGC129586, NME9, thioredoxin domain containing 6, thioredoxin domain-containing protein 6, thioredoxin-like 2, Thioredoxin-like protein 2, TXL2, TXL-2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTV
• Quantity: 25 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 347736
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified