Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB301241

TXNL4A Antibody, Novus Biologicals™
SDP

Catalog No. NB301241 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB301241 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB301241 Supplier Novus Biologicals Supplier No. NBP325211
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

TXNL4A Polyclonal antibody specifically detects TXNL4A in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen TXNL4A
Applications Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias DIB1, DIM1 protein homolog, DIM1Thioredoxin-like U5 snRNP protein U5-15kD, HsT161, Spliceosomal U5 snRNP-specific 15 kDa protein, thioredoxin-like 4, thioredoxin-like 4A, thioredoxin-like protein 4A, TXNL4, U5-15kD
Host Species Rabbit
Immunogen This antibody has been engineered to specifically recognize the recombinant protein TXNL4A using the following amino acid sequence: DITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRG
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cell Biology
Primary or Secondary Primary
Gene ID (Entrez) 10907
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.