Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TXNL4A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | TXNL4A |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TXNL4A Polyclonal specifically detects TXNL4A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
TXNL4A | |
Polyclonal | |
Rabbit | |
DIB1, DIM1 protein homolog, DIM1Thioredoxin-like U5 snRNP protein U5-15kD, HsT161, Spliceosomal U5 snRNP-specific 15 kDa protein, thioredoxin-like 4, thioredoxin-like 4A, thioredoxin-like protein 4A, TXNL4, U5-15kD | |
TXNL4A | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
10907 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNK | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title