Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Tyrosine Hydroxylase Antibody (CL3049), Novus Biologicals™

Tyrosine Hydroxylase Antibody (CL3049), Novus Biologicals™
SDP

Catalog No. NB396372 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396372 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396372 Supplier Novus Biologicals Supplier No. NBP24664725UL
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Tyrosine Hydroxylase Monoclonal antibody specifically detects Tyrosine Hydroxylase in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen Tyrosine Hydroxylase
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL3049
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2), 40% Glycerol
Gene Accession No. P07101
Gene Alias DYT14, DYT5b, EC 1.14.16, EC 1.14.16.2, TH, TYH dystonia 14, Tyrosine 3-hydroxylase, tyrosine 3-monooxygenase, tyrosine hydroxylase
Host Species Mouse
Immunogen This Tyrosine Hydroxylase Antibody (CL3049) is made against a recombinant protein epitope signature tag (PrEST) antigen sequence corresponding to AA465-528 of human tyrosine hydroxylase (UniProtKB - P07101): SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Neurotransmission, Prostate Cancer
Primary or Secondary Primary
Gene ID (Entrez) 7054
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.