Tyrosine Hydroxylase Antibody (CL3049), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP24664725UL

Catalog No. NB396372

Description

Tyrosine Hydroxylase Monoclonal antibody specifically detects Tyrosine Hydroxylase in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Tyrosine Hydroxylase
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Gene Alias: DYT14, DYT5b, EC 1.14.16, EC 1.14.16.2, TH, TYH dystonia 14, Tyrosine 3-hydroxylase, tyrosine 3-monooxygenase, tyrosine hydroxylase
• Immunogen: This Tyrosine Hydroxylase Antibody (CL3049) is made against a recombinant protein epitope signature tag (PrEST) antigen sequence corresponding to AA465-528 of human tyrosine hydroxylase (UniProtKB - P07101): SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
• Quantity: 25 μL
• Research Discipline: Cancer, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Neurotransmission, Prostate Cancer
• Gene ID (Entrez): 7054
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Clone: CL3049
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: P07101
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified