Tyrosine Hydroxylase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23890325UL

Catalog No. NB404624

Description

Tyrosine Hydroxylase Polyclonal specifically detects Tyrosine Hydroxylase in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Tyrosine Hydroxylase
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: P07101
• Gene Symbols: TH
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human Tyrosine Hydroxylase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DYT14, DYT5b, EC 1.14.16, EC 1.14.16.2, TH, TYH dystonia 14, Tyrosine 3-hydroxylase, tyrosine 3-monooxygenase, tyrosine hydroxylase
• Host Species: Rabbit
• Molecular Weight of Antigen: 60 kDa
• Quantity: 25 μL
• Research Discipline: Cancer, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Neurotransmission, Phospho Specific, Prostate Cancer
• Gene ID (Entrez): 7054
• Target Species: Human, Mouse
• Isotype: IgG