TYRP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169542

Catalog No. NBP169542

Description

TYRP1 Polyclonal antibody specifically detects TYRP1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

• Antigen: TYRP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: b-PROTEIN, CAS25,6-dihydroxyindole-2-carboxylic acid oxidase, Catalase B, CATB, EC 1.14.18, EC 1.14.18.-, EC 1.14.18.1, Glycoprotein 75, GP75DHICA oxidase, Melanoma antigen gp75, TRP-1, TRPTYRP, tyrosinase-related protein 1TRP1, TYRRP
• Host Species: Rabbit
• Molecular Weight of Antigen: 61 kDa
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 7306
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P17643
• Gene Symbols: TYRP1
• Immunogen: Synthetic peptides corresponding to TYRP1(tyrosinase-related protein 1) The peptide sequence was selected from the middle region of TYRP1. Peptide sequence NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only