Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TYW1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23856325UL
Description
TYW1B Polyclonal specifically detects TYW1B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TYW1 | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q9NV66 | |
TYW1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: RVMSRGEGDCDVVKSKHGSIEANFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSQEQDELHHR | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
LINC00069, Long Intergenic Non-Protein Coding RNA 69, NCRNA00069, Non-Protein Coding RNA 69, Radical S-Adenosyl Methionine And Flavodoxin Domain-Containing Protein 2, radical S-adenosyl methionine and flavodoxin domains 1, RSAFD2, S-Adenosyl-L-Methionine-Dependent TRNA 4-Demethylwyosine Synthase, TRNA Wybutosine-Synthesizing Protein 1 Homolog B TRNA-YW Synthesizing Protein 1 Homolog B, TRNA-YW Synthesizing Protein 1 Homolog B (Non-Protein Coding), TRNA-YW Synthesizing Protein 1 Homolog B (S. Cerevisiae) | |
Rabbit | |
Affinity Purified | |
RUO | |
55253 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction