Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
u-Plasminogen Activator/Urokinase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$330.00 - $547.00
Specifications
Antigen | u-Plasminogen Activator/Urokinase |
---|---|
Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
u-Plasminogen Activator/Urokinase Polyclonal antibody specifically detects u-Plasminogen Activator/Urokinase in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
u-Plasminogen Activator/Urokinase | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Cancer | |
PBS, pH 7.2, 40% glycerol | |
5328 | |
IgG | |
Affinity purified |
Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
ATF, EC 3.4.21, EC 3.4.21.73, plasminogen activator, urokinase, uPA, u-PA, U-plasminogen activator, urinary, urokinase-type plasminogen activator | |
This antibody was developed against Recombinant Protein corresponding to amino acids: KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYP | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title