Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. U11/U12-35K Antibody, Novus Biologicals™

U11/U12-35K Antibody, Novus Biologicals™
SDP

Catalog No. p-7107552 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157499 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157499 Supplier Novus Biologicals Supplier No. NBP157499
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

U11/U12-35K Polyclonal specifically detects U11/U12-35K in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen U11/U12-35K
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q5XKN9
Gene Alias HM1, HM-1, MGC138160, Protein HM-1, small nuclear ribonucleoprotein 35kDa (U11/U12), U1 snRNP-binding protein homolog, U11/U12 small nuclear ribonucleoprotein 35 kDa protein, U11/U12 snRNP 35 kDa protein, U11/U12 snRNP 35K, U11/U12-35K, U1-snRNP binding protein homolog, U1SNRNPBPU1 snRNP binding protein homolog
Gene Symbols SNRNP35
Host Species Rabbit
Immunogen Synthetic peptides corresponding to U11/U12-35K The peptide sequence was selected from the N terminal of U11/U12-35K. Peptide sequence RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11066
Test Specificity Expected identity based on immunogen sequence: Human: 100%Mouse: 92%; Bovine: 92%; Zebra finch: 85%; Rat: 85%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.