UBA1 Rabbit anti-Human, Mouse, Rat, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against recombinant human UBA1.

Supplier:  Abnova Corporation PAB29508

Catalog No. 89-935-072

Description

The protein encoded by this gene catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11.23. Alternatively spliced transcript variants that encode the same protein have been described. [provided by RefSeq]

Sequence: LAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVP

Specifications

• Antigen: UBA1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant human UBA1.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Symbols: UBA1
• Immunogen: Recombinant protein corresponding to human UBA1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
• Gene Alias: A1S9/A1S9T/A1ST/AMCX1/GXP1/MGC4781/SMAX2/UBA1A/UBE1/UBE1X
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 7317
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG