Invitrogen™ UBA3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA580200

Catalog No. PIPA580200

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human HEK293 whole cell, rat brain tissue. IHC: rat testis tissue, mouse testis tissue. ICC/IF: A431 cell. Flow: A549 cell.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, a ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Specifications

• Antigen: UBA3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Uba3
• Gene Alias: A830034N06Rik; AI256736; AI848246; AW546539; DKFZp566J164; hUBA3; MGC22384; NAE2; NEDD8-activating enzyme E1 catalytic subuni-like protein; NEDD8-activating enzyme E1 catalytic subunit; NEDD8-activating enzyme E1 subunit 2; NEDD8-activating enzyme E1C; Nedd8-activating enzyme hUba3; Uba3; UBA3, ubiquitin-activating enzyme E1 homolog; UBE1C; ubiquitin like modifier activating enzyme 3; ubiquitin-activating enzyme 3; Ubiquitin-activating enzyme E1C; ubiquitin-activating enzyme E1C (homologous to yeast UBA3); ubiquitin-activating enzyme E1C (UBA3 homolog, yeast); ubiquitin-like modifier activating enzyme 3; ubiquitin-like modifier-activating enzyme 3; Unknown (protein for MGC:140052); wu:fb75e04; wu:fc37b11; zgc:55528
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 117553, 22200, 9039
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q8C878, Q8TBC4, Q99MI7
• Gene Symbols: Uba3
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human UBE1C (409-448aa KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov