UBASH3B/STS1/Tula-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325213

Catalog No. NB301239

Description

UBASH3B/STS1/Tula-2 Polyclonal antibody specifically detects UBASH3B/STS1/Tula-2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: UBASH3B/STS1/Tula-2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: Cbl-interacting protein p70, Cbl-interacting protein Sts-1, KIAA1959SH3 domain-containing 70 kDa protein, suppressor of T-cell receptor signaling1, nm23-phosphorylated unknown substrate, MGC15437, nm23-phosphorylated unknown substrate, P70, STS1EC 3.1.3.48, STS-1ubiquitin-associated and SH3 domain-containing protein B, Suppressor of T-cell receptor signaling 1, T-cell ubiquitin ligand 2, TULA-2, Tyrosine-protein phosphatase STS1/TULA2, ubiquitin associated and SH3 domain containing B
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein UBASH3B/STS1/Tula-2 using the following amino acid sequence: YGTSLTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGETTPLTIICQPM
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84959
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG