Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. UBASH3B/STS1/Tula-2 Antibody, Novus Biologicals™

UBASH3B/STS1/Tula-2 Antibody, Novus Biologicals™
SDP

Catalog No. NB436655 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB436655 25 μL
NBP234053 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB436655 Supplier Novus Biologicals Supplier No. NBP23405325UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

UBASH3B/STS1/Tula-2 Polyclonal specifically detects UBASH3B/STS1/Tula-2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen UBASH3B/STS1/Tula-2
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q8TF42
Gene Alias Cbl-interacting protein p70, Cbl-interacting protein Sts-1, KIAA1959SH3 domain-containing 70 kDa protein, suppressor of T-cell receptor signaling1, nm23-phosphorylated unknown substrate, MGC15437, nm23-phosphorylated unknown substrate, P70, STS1EC 3.1.3.48, STS-1ubiquitin-associated and SH3 domain-containing protein B, Suppressor of T-cell receptor signaling 1, T-cell ubiquitin ligand 2, TULA-2, Tyrosine-protein phosphatase STS1/TULA2, ubiquitin associated and SH3 domain containing B
Gene Symbols UBASH3B
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: CEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKEDSAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASH
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 84959
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.