Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. UbcH10/UBE2C Antibody, Novus Biologicals™

UbcH10/UBE2C Antibody, Novus Biologicals™
SDP

Catalog No. NBP238745 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP238745 0.1 mL
NB436110 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP238745 Supplier Novus Biologicals Supplier No. NBP238745
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

UbcH10/UBE2C Polyclonal specifically detects UbcH10/UBE2C in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen UbcH10/UBE2C
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. O00762
Gene Alias cyclin-selective ubiquitin carrier protein, dJ447F3.2, EC 6.3.2.19, UbcH10, UBCH10mitotic-specific ubiquitin-conjugating enzyme, Ubiquitin carrier protein C, ubiquitin carrier protein E2-C, ubiquitin-conjugating enzyme E2 C, ubiquitin-conjugating enzyme E2C, Ubiquitin-protein ligase C
Gene Symbols UBE2C
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Mitotic Regulators
Primary or Secondary Primary
Gene ID (Entrez) 11065
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.