Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. UbcH2/UBE2H Rabbit anti-Rat, Polyclonal, Novus Biologicals™

UbcH2/UBE2H Rabbit anti-Rat, Polyclonal, Novus Biologicals™
SDP

Catalog No. p-7232855 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB126027 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB126027 Supplier Novus Biologicals Supplier No. NBP310563100UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

UbcH2/UBE2H Polyclonal specifically detects UbcH2/UBE2H in Rat samples. It is validated for Western Blot.

Specifications

Antigen UbcH2/UBE2H
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias EC 6.3.2.19, UBC8E2-20K, UBCH, UBCH2, Ubiquitin carrier protein H, ubiquitin-conjugating enzyme E2 H, Ubiquitin-conjugating enzyme E2-20K, ubiquitin-conjugating enzyme E2H (homologous to yeast UBC8), ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast), Ubiquitin-protein ligase H
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Rat UbcH2/UBE2H (NP_001165598). Peptide sequence FESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEAL
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7328
Target Species Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.