UbcH5a/UBE2D1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155033

Catalog No. NBP155033

Description

UbcH5a/UBE2D1 Polyclonal antibody specifically detects UbcH5a/UBE2D1 in Human, Rat samples. It is validated for Western Blot.

Specifications

• Antigen: UbcH5a/UBE2D1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: E2(17)KB1, Stimulator of Fe transportUBC4/5 homolog, UBC4/5, UBC5A, UbcH5, UbcH5A, UBCH5AEC 6.3.2.19, UBCH5SFT, Ubiquitin carrier protein D1, ubiquitin-conjugating enzyme E2 D1, Ubiquitin-conjugating enzyme E2(17)KB 1, Ubiquitin-conjugating enzyme E2-17 kDa 1, ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast), Ubiquitin-protein ligase D1
• Host Species: Rabbit
• Molecular Weight of Antigen: 16 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, Hypoxia
• Gene ID (Entrez): 7321
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P51668
• Gene Symbols: UBE2D1
• Immunogen: Synthetic peptides corresponding to UBE2D1(ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the middle region of UBE2D1. Peptide sequence SQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Guinea pig: 79%.
• Target Species: Human, Rat, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Form: Purified

For Research Use Only