UbcH5c/UBE2D3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155276

Catalog No. NBP155276

Description

UbcH5c/UBE2D3 Polyclonal specifically detects UbcH5c/UBE2D3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UbcH5c/UBE2D3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: E2(17)KB 3, E2(17)KB3, EC 6.3.2.19, MGC43926, MGC5416, UBC4/5, UBC5C, UBCH5C, Ubiquitin carrier protein D3, ubiquitin-conjugating enzyme E2 D3, Ubiquitin-conjugating enzyme E2(17)KB 3, Ubiquitin-conjugating enzyme E2-17 kDa 3, ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5), ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast), Ubiquitin-protein ligase D3
• Host Species: Rabbit
• Molecular Weight of Antigen: 17 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P61077
• Gene Symbols: UBE2D3
• Immunogen: Synthetic peptides corresponding to UBE2D3(ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the N terminal of UBE2D3. Peptide sequence MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7323
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

For Research Use Only