UbcH7/UBE2L3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24936725UL

Catalog No. NB395719

Description

UbcH7/UBE2L3 Polyclonal antibody specifically detects UbcH7/UBE2L3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: UbcH7/UBE2L3
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: E2-F1, EC 6.3.2.19, L-UBC, UBCE7, UbcH7, UBCH7UbcM4, Ubiquitin carrier protein L3, ubiquitin-conjugating enzyme E2 L3, Ubiquitin-conjugating enzyme E2-F1, ubiquitin-conjugating enzyme E2L 3, ubiquitin-conjugating enzyme UBCH7, Ubiquitin-protein ligase L3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
• Quantity: 25 μL
• Research Discipline: Cancer, DNA Repair, Tumor Suppressors
• Gene ID (Entrez): 7332
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified