Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UbcH8/Ube2L6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15503720UL
Description
UbcH8/Ube2L6 Polyclonal specifically detects UbcH8/Ube2L6 in Human samples. It is validated for Western Blot.Specifications
UbcH8/Ube2L6 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
O14933 | |
UBE2L6 | |
Synthetic peptides corresponding to UBE2L6(ubiquitin-conjugating enzyme E2L 6) The peptide sequence was selected from the middle region of UBE2L6. Peptide sequence QVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRP. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
EC 6.3.2.19, retinoic acid induced gene B protein, Retinoic acid-induced gene B protein, RIG-B, UbcH8, UBCH8MGC40331, Ubiquitin carrier protein L6, ubiquitin/ISG15-conjugating enzyme E2 L6, ubiquitin-conjugating enzyme E2L 6, Ubiquitin-protein ligase L6 | |
Rabbit | |
18 kDa | |
20 μL | |
Stem Cell Markers | |
9246 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction