Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UbcH8/Ube2L6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | UbcH8/Ube2L6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155037
|
Novus Biologicals
NBP155037 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP15503720
|
Novus Biologicals
NBP15503720UL |
20 μL | N/A | N/A | N/A | ||||
Description
UbcH8/Ube2L6 Polyclonal specifically detects UbcH8/Ube2L6 in Human samples. It is validated for Western Blot.Specifications
| UbcH8/Ube2L6 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| EC 6.3.2.19, retinoic acid induced gene B protein, Retinoic acid-induced gene B protein, RIG-B, UbcH8, UBCH8MGC40331, Ubiquitin carrier protein L6, ubiquitin/ISG15-conjugating enzyme E2 L6, ubiquitin-conjugating enzyme E2L 6, Ubiquitin-protein ligase L6 | |
| UBE2L6 | |
| IgG | |
| 18 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O14933 | |
| 9246 | |
| Synthetic peptides corresponding to UBE2L6(ubiquitin-conjugating enzyme E2L 6) The peptide sequence was selected from the middle region of UBE2L6. Peptide sequence QVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title