UBE1 Polyclonal Antibody

UBE1 Polyclonal Antibody

Supplier:  Thermo Scientific PA595346

Catalog No. PIPA595346

Description

UBE1 Polyclonal Antibody for Western Blot

Specifications

• Antigen: UBE1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: UBA1
• Gene Alias: A1S9; A1S9 protein; A1S9T; A1S9T and BN75 temperature sensitivity complementing; A1ST; AMCX1; CFAP124; EMBL:AAH85791.1, ECO:0000312; GXP1; POC20; POC20 centriolar protein homolog; Protein A1S9; RGD:1359327}; Sbx; SMAX2; testicular secretory protein Li 63; Uba1; uba1 {ECO:0000312; UBA1, ubiquitin-activating enzyme E1 homolog A; UBA1A; UBE1; Ube-1; Ube1ax; Ube1x; ubiquitin like modifier activating enzyme 1; Ubiquitin-activating enzyme E1; ubiquitin-activating enzyme E1 {ECO:0000250; Ubiquitin-activating enzyme E1 X; ubiquitin-activating enzyme E1, Chr X; ubiquitin-like modifier activating enzyme 1; ubiquitin-like modifier-activating enzyme 1; ubiquitin-like modifier-activating enzyme 1 {ECO:0000250; Ubiquitin-like modifier-activating enzyme 1 X; UniProtKB:Q02053}
• Host Species: Rabbit
• Purification Method: Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 22201, 314432, 7317
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P22314, Q02053, Q5U300
• Gene Symbols: UBA1
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human UBA1 (102-139aa HDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELN).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG