Invitrogen™ UBE2Q2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA580202

Catalog No. PIPA580202

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, A431 whole cell, MCF-7 whole cell, SW620 whole cell. IHC: human lung cancer tissue. ICC/IF: U20S cell. Flow: A549 cell.

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. [UniProt].

Specifications

• Antigen: UBE2Q2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: UBE2Q2
• Gene Alias: 3010021M21Rik; DKFZp762C143; E2 ubiquitin-conjugating enzyme Q2; RGD1307680; UBE2Q2; Ubiquitin carrier protein Q2; ubiquitin conjugating enzyme E2 Q2; ubiquitin conjugating enzyme E2Q family member 2; ubiquitin conjugating enzyme-implantation induced; ubiquitin-conjugating enzyme E2 Q2; ubiquitin-conjugating enzyme E2Q (putative) 2; ubiquitin-conjugating enzyme E2Q 2; ubiquitin-conjugating enzyme E2Q family member 2; ubiquitin-conjugating enzyme UBCi; Ubiquitin-protein ligase Q2; Unknown (protein for MGC:134315); wu:fi34a03; zgc:56219
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 92912
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q8WVN8
• Gene Symbols: UBE2Q2
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human UBE2Q2 (83-123aa LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov